PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.107730.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 223aa    MW: 25537.9 Da    PI: 8.4879
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.107730.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.34.2e-141461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l   + + G g+W++++ + g+ R  k+c++rw++yl
   Cucsa.107730.1 14 KGLWSPEEDEKLRSFILKNGHGCWTSVPIKAGLLRNSKSCRLRWFNYL 61
                     678*****************************99************97 PP

2Myb_DNA-binding49.21.2e-1567118148
                      TSSS-HHHHHHHHHHHHHTTTT.....-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg.....tWktIartmgkgRtlkqcksrwqkyl 48 
                      rg ++++Ede+++ ++++lG++     +W+ Ia+++  gRt++++k++w+++l
   Cucsa.107730.1  67 RGMFSQQEDEKILTLHRLLGNRmmisiRWSQIAQHLA-GRTDNEIKNYWNSHL 118
                      788**********************************.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.866961IPR017930Myb domain
SuperFamilySSF466891.17E-2412114IPR009057Homeodomain-like
SMARTSM007177.9E-111363IPR001005SANT/Myb domain
PfamPF002497.5E-131461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-191568IPR009057Homeodomain-like
CDDcd001672.12E-81761No hitNo description
PROSITE profilePS5129421.23862122IPR017930Myb domain
SMARTSM007176.6E-1266120IPR001005SANT/Myb domain
PfamPF002494.3E-1467118IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-2469122IPR009057Homeodomain-like
CDDcd001671.13E-1070118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MGCRETEKEK VKKKGLWSPE EDEKLRSFIL KNGHGCWTSV PIKAGLLRNS KSCRLRWFNY  60
LRPGLKRGMF SQQEDEKILT LHRLLGNRMM ISIRWSQIAQ HLAGRTDNEI KNYWNSHLKK  120
KVVLNFQDLK SGVFSNRDPP LEEMGSSGNE RIESQPRVLF AEWLSVSDVN GGSSMEGSFD  180
GEGRRTSREG YGFEMLNWDL DFEGHISDGF ATCDQLCREQ TG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-22141227108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818481e-93LN681848.1 Cucumis melo genomic scaffold, anchoredscaffold00006.
GenBankLN7132601e-93LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011652772.11e-145PREDICTED: LOW QUALITY PROTEIN: transcription factor LAF1-like
SwissprotQ9M0K42e-52LAF1_ARATH; Transcription factor LAF1
TrEMBLA0A0A0L6I11e-135A0A0A0L6I1_CUCSA; Uncharacterized protein
STRINGGLYMA10G38110.14e-59(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38303161
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25560.19e-54myb domain protein 18